Dbget search swiss prot
WebIn order to have minimal redundancy and to improve sequence reliability, all protein sequences encoded by a same gene are merged into a single UniProtKB/Swiss-Prot entry. Differences found between various sequencing reports are analysed and fully described in the feature table (alternative splicing events, genetic variations or conflicts for ... WebGlyceraldehyde-3-phosphate CC dehydrogenase is a key enzyme in glycolysis that catalyzes the first CC step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) CC into 3-phospho-D-glyceroyl phosphate (By similarity). Participates in CC nuclear events including transcription, RNA transport, DNA replication CC and apoptosis.
Dbget search swiss prot
Did you know?
WebMay 1, 2013 · DBGET DBGET has three basic commands (or three basic modes in the Web version), bfind, bget, and blink, to search and extract database entries. bget – performs the retrieval of database entries … WebJan 1, 2001 · The SWISS-PROT protein sequence database and its supplement TrEMBL in 2000. SWISS-PROT is a curated protein sequence database which strives to provide a high level of annotation (such as the description of the function of a protein, its domains structure, post-translational modifications, variants, etc.), a minimal level of redundancy and high ...
WebJan 1, 1997 · SWISS-PROT is a curated protein sequence database which strives to provide a high level of annotations (such as the description of the function of a protein, … WebDBGET retrieval system is developed in the University of Tokyo. This system provides the multiple databases of molecular biology database entry at a time. The home page of DBGET is shown in Fig. ...
WebSWISS-PROT establishes cross-references with a variety of databases databases, such as the protein tertiary structure library PDB, the human gene Mendelian genetic database (MIM), the protein type and the site … WebMCQ on Bioinformatics- Biological databases. Biological Databases. 1. Margaret Dayhoff developed the first protein sequence database called. a) SWISS PROT. b) PDB. c) Atlas of protein sequence and structure. d) Protein sequence databank. 2.
WebID PER4_VITVI Reviewed; 321 AA. AC A7NY33; DT 10-FEB-2009, integrated into UniProtKB/Swiss-Prot. DT 02-OCT-2007, sequence version 1.
WebThe HAMAP and PROSITE databases of protein families and domains, the ENZYME database of enzyme nomenclature, the SwissLipids database of lipid structures and … bateria para xbox 360 guitar heroWebDBGET search - SWISS-PROT. Database: SWISS-PROT. SWISS-PROT protein sequence database. Release 2024_01, Feb 23. Swiss Institute of Bioinformatics; … bateria para xbox 360 rock bandWebJul 7, 2024 · DBGET is an integrated database retrieval system for major biological databases, which are classified into five categories: Databases in the third category are … bateria para xbox 360 slimWebTarget protein database for scans of motifs against whole protein databases: 'sp' (UniProtKB/Swiss-Prot) or 'tr' (UniProtKB/TrEMBL reference proteomes sequences) or … td bank rimouskitd bank republica dominicanaWebMar 9, 2012 · DBGETis a simple database retrieval system for a diverse range of molecular biology databases. Here a database is considered simply as a set of entries, which may … bateria para x1 2019Webgenome browser: aa seq: 718 aa aa seq db search mmfrdqvgvlagwfkgwneceqtvallsllkrvsqtqarflqlclehsladcaelhvler eanspgiinqwqqeskdkvislllthlpllkpgnldakveymkllpkilahsiehnqhie bateria para xbox one